PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G23800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 337aa    MW: 36455.9 Da    PI: 7.4993
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G23800.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26066.18.5e-21751145
           DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkl 45
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kl
  OPUNC03G23800.1  7 PCAACKLLRRKCTQGCVFAPYFPPDQPAKFANVHKVFGASNVTKL 51
                     7******************************************97 PP

2DUF260115.53.3e-365214210100
           DUF260  10 rkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                      rkC++dCv+apyfp +qp+kfanvhk+FGasnv+kll++l++e+reda++sl+yeAear+rdPvyG+v+ i+ lq +++q++ +++ +++e
  OPUNC03G23800.1  52 RKCQPDCVFAPYFPPDQPAKFANVHKVFGASNVTKLLNDLQPEQREDAVNSLAYEAEARLRDPVYGCVAYISILQLRIKQVRDQIVDARKE 142
                      89**********************************************************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.3396143IPR004883Lateral organ boundaries, LOB
PfamPF031959.1E-20751IPR004883Lateral organ boundaries, LOB
PIRSFPIRSF0381558.0E-9152337IPR017414LOB domain-containing protein 10/36/41
PfamPF031952.8E-3552139IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MSSSSSPCAA CKLLRRKCTQ GCVFAPYFPP DQPAKFANVH KVFGASNVTK LRKCQPDCVF  60
APYFPPDQPA KFANVHKVFG ASNVTKLLND LQPEQREDAV NSLAYEAEAR LRDPVYGCVA  120
YISILQLRIK QVRDQIVDAR KELAAYIGPT AFAPVVAAAA PHPHYLPPAD YHHQLQVQGG  180
GMGGGVPVAA GYAHQVQHQM AGLQVQHPHH HHHHQQMVNA QHMALAVEVA RDQDMLRARQ  240
AGHANAGATV AVEAPGSSLN ADTFDGGPFL LRQQPPSSVQ TEPAMALPYH MEPSPPQPSS  300
GHSHDEVSQH HPHHQHHHRH HHTDGSDEGS GGAAPPG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629364.11e-152PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ32e-54LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0E0KGA70.0A0A0E0KGA7_ORYPU; Uncharacterized protein
STRINGLOC_Os03g41600.11e-152(Oryza sativa Japonica Group)
STRINGORGLA03G0240600.11e-152(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-51ASYMMETRIC LEAVES 2-like 1